Diskusné fórum

Join the forum, it's quick and easy

Diskusné fórum
Diskusné fórum
Would you like to react to this message? Create an account in a few clicks or log in to continue.

Scarlett
Posts : 565
Join date : 10.01.2021
Zobrazit informácie o autorovi
12112021
zaujal ma jeden komentar z Q. k gen. entropii





Zdá sa, že genetická entropia je vynálezom Johna Sanforda.

Genetická entropia Rád predáva svoju knihu s rovnakým názvom. "DR. John Sanford z Cornell University predstavuje Genetickú entropiu s podrobnými vedeckými údajmi podporujúcimi Písmo.“


Takže toto je ďalší kreacionistický pokus vyvrátiť evolúciu. Základnou myšlienkou je, že všetky zmeny (mutácie) v DNA majú za následok degradáciu informácie v DNA. IOW, strata informácií. Stratiť príliš veľa informácií a život sa zastaví.

Je iróniou, že základná odpoveď pochádza od iného kreacionistu: Williama Dembského! Ukazuje sa, že prirodzený výber zvyšuje informovanosť. Takže tieto zmeny, ktoré znepokojujú Sanford, „nenarušujú informácie“, ale pridávajú informácie. Dembski: „Predpokladajme, že organizmus pri reprodukcii generuje N potomkov a že z týchto N potomkov M sa podarí rozmnožiť. Množstvo informácií vnesených prostredníctvom selekcie je potom -log2(M/N). Dovoľte mi zdôrazniť, že tento vzorec nie je prípad nesprávne umiestnenej matematickej presnosti. Tento vzorec platí univerzálne a nie je záhadný.

Vezmite si jednoduchý nebiologický príklad. Ak sedím pri rádiovom vysielači a dokážem vysielať iba nuly a jednotky, potom zakaždým, keď vysielam nulu alebo jednotku , vyberám si z dvoch možností, pričom vyberiem práve jednu z nich. Tu sa N rovná 2 a M sa rovná 1. Informácia -log2(M/N) sa teda rovná -log2(1/2) = 1, tj 1 bit informácie n sa zavedie vždy, keď prenesiem nulu alebo jednotku. Tak je to samozrejme tak, ako by to malo byť. Tento príklad z teórie komunikácie je matematicky izomorfný s prípadom delenia buniek, kde sa reprodukuje iba jedna z dcérskych buniek. na druhej strane, ak obe dcérske bunky pokračujú v reprodukcii, nN sa rovná M sa rovná 2, a teda -log2(M/N) = -log2(2/2) = 0, čo naznačuje, že výber zlyhaním pri eliminácii akejkoľvek možnosti zlyhal pri zavedení novej informácie.


http://www.arn.org/docs/dembski/wd_idtheory.htm



V reálnych populáciách sa rodí viac jedincov, ako prežije, aby sa rozmnožilo. Takže N je vždy > M. To znamená, že M/N je vždy <1, čo znamená, že „p“ je vždy menšie ako 1, čo zase znamená záporný logaritmus. So znakom „-“ vpredu to vždy znamená pozitívnu informáciu. Toľko o „genetickej entropii“. Prirodzený výber tomu bráni.

Fotón Súhlasí

Share this post on:redditgoogle

Komentáre

Fotón
Diskutoval som predbežne s Tomášom, ale vyjadrím sa postupne aj k tomu.
Scarlett
gen. entropia je dost zaujimava tematika pre kreacionizmus . preco si k tomu nic nepridal (?)
Admin
Príspevok bol zmazaný. Varoval som ťa, že keď začneš točiť už len o tom istom bez informačného obsahu, opakovať len nezmyselné tvrdenia bez náväznosti na predkladané argumenty, bude koniec. Už si s tým tvojicm chorobným spamovaním začal. Takže prišiel koniec tvojej účasti na fóre. Ale tentoraz si vydrfžal pomerne dlho s nízkou mierou spamu v príspevkoch.
Fotón
Žiadne medzičlánky tam nie sú, ale hotové druhy. Hlúposť bez najmenšej štipky dôkazu. Tie ryby a obojživelníci vyzerali tak od začiatku, keď boli stvorené. S možnosťou pohybu vo vode i na súši. S naplno fungujúcou možnosťou pohybu v oboch prostrediach. To zachvíľu bude aj krokodýl medzičlánok alebo vtákopysk medzi cicavcami a vtákmi.  ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f604  Vymyslieť sa dá čokokoľvek..... (Ľudia sú schopní uveriť kdejakým hoaxom.)
Rozmanitosť živočíchov s rôznymi kombináciami fenotypu nie sú dôkaz evolúcie, ale kreativity tvorcu. Jeho zmyslu pre rozmanitosť, ako opak jednotvárnosti. To je celé. Žiadne známky vývoja, ale hotové a funkčné druhy.
V biblii je aj táto skutočnosť oznámená:
Gn 1:21
A Boh stvoril tie veľké ryby a všelijakú dušu živú, hýbajúcu sa, ktorými sa hemžia vody, podľa ich druhu, a všelijaké vtáctvo okrýdlené podľa jeho druhu. A Boh videl, že je to dobré.
Čiže Boh stvoril širokú škálu rozmanitosti života. Dokonca aj toto:

To je zas prechodný článok čoho? ....No vymyslieť sa dá čokoľvek.  Very Happy Evolučná teória sa vždy evolučne prispôsobí nejakými tvrdeniami (samozrejme bez dôkazu). Lebo je to ideológia - nemajú na výber, inak by museli pripustiť myšlienku stvoriteľa. Toho sa však maximálne stránia.

Ty žiješ predovšetkým vo svojich fantazíjnych výmysloch (=nezmysloch). Už si si prečítal obsah logického klamu, ktorý tak často používaš? Aspoň 3x za deň. .....Zase porovnávaš hrušky a traktory. Používaš klamnú analógiu s úplne nesúvisiacimi vecami. Účinok očkovania dokazujú výsledky jeho použitia - a aj to sa  musí najprv testovať, aby bolo môžné prehlásiť, že látka je účinná. Kedy v laboratóriu otestujú premenu napr. tripod fish na suchozemského živočícha?  Basketball
....A ako keby to nestačilo, ešte viac sa zosmiešňuješ porovnávaním chirurgických výkonov s evolúciou, ktoré sú dokázané mnohými výsledkami s výmyslami o biodiverzite (čeľadí, tried) zo spoločných predkov. Niečo, čo nikto nikdy nepozoroval a ani s pricípu pozorovať nemôže. Keby chirurg používal pri operáciách princípy neodarwinizmu, takmerkaždý pacient by mu zomrel na operačnom stole.
Klamná analógia porovnáva dva celkom nesúvisiace javy a tvrdí, že ak má jeden nejakú vlastnosť, musí ju mať aj druhý.
https://sk.wikipedia.org/wiki/Logick%C3%BD_klam#Klamn%C3%A1_anal%C3%B3gia

Veď si ten zdroj ani neotvoril, len si zas domýšľaš, čo v ňom asi je. Sú to vedci s titulmi, v drvivej väčšine pracujúci vo svojom obore. Neviem, prečo máš tak panický strach čítať zdroje, ktoré dávam. Aby sa tvoje hlúposti ktoré si si ponavymýšľal nerozpadli, ako domček z kariet? Tak aspoň vzorka:

Raul Leguizamon is Professor of Medicine (Pathology) at Autonomous University of Guadalajara in Mexico.

Egbert Giles Leigh, Jr. PhD Staff scientist, biologist, Smithsonian Tropical Research Institute, Balboa, Canal Zone, Republic of Panama, formerly Princeton University, Princeton, NJ, Assistant Professor of biology., Education: Princeton University, B.A., Yale University, Ph.D.

Matti Leisola Ph.D. is Professor of Bioprocess Engineering and head of the Department of Chemical
Technology at Helsinki University of Technology, Finland. His M.S., Lic.Sc. and D.Sc. (Ph.D.) are all from Helsinki University of Technology and his Habilitation is from Swiss Federal Institute of Technology (ETH), all in biotechnology. His work is primarily in enzyme technology and he has supervised over 100 masters and 15 doctoral theses.

Jérôme Jean Louis Marie Lejeune PhD MD The father of modern genetics. Professor fundamental genetics, Faculty Medicine, Necker-Enfants Malades, Paris. Education: The University of Paris (M.D., 1951; Ph.D., 1960). In 1959, Lejeune identified the human chromosomal abnormality linked to Down syndrome, or trisomy 21.

Magda Narciso Leite PhD is Professor, College of Pharmacy and Biochemistry at the Universidade Federal de Juiz de For a in Brazil.

atď.....

Pokiaľ si schopný aspoň trochu používať internet, dohľadáš si podľa mien všetko. Sú to vedci pracujúci vo svojich oboroch, genetika, biológia...

Opakujem oznam:
Dnes máš dostupné videá komplet celých vš semestrov z ktorých sa dozvieš to isté, ako keby si tam bol. Už stačí len nebyť hlúpy, rozumieť a učiť sa (...čo ty samozrejme robiť nebudeš). Minule si odmietol tému v ktorej som ťa navigoval na vedecké prednášky a ďalšie vzdelávanie. Takže je jasné, že sa od teba dajú do budúcnosti čakať len hlúposti, dupotanie nožičkami, hádzanie sa o zem presadzujúc plno nezmyslov, neschopnosť chápať odkazy na vedecké články, domýšľavosť a pod... To čo stále robíš.

Toto nie je hra na percentá a hlasovanie. 3000 vedcov neprijalo evolúciu, lebo nie je vedecky dokázaná, ako napr. STR či VTR. Si snáď ty, človek bez záujmu o vzdelávanie múdrejší, ako oni všetci? (Tvoj argument, keby čosi...)  ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f604

Pokiaľ nie si schopný používať gogoole (čiže ani nevieš, čo je "google schollar" kde si ľahko zadáš vybrané meno a dostaneš sa k prácam), nemáš tu čo robiť a kradnúť čas svojimi nezmyslami.

Miesto študovania sa znovu začínaš len opakovať svoje nezmyselné tvrdenia. Tvoje príspevky sú o5 na zostupre do úrovne fekálii. Ak nie si schopný priniesť už nič nové a len stále opakovať čo som už vyvrátil, zablokujem ti sem prístup. Jediné čoho si už schopný je iba negovanie slov oponenta.

Lenskiho E-Coli nie sú dôkazom náhodných mutácii. Baktérie majú mechanizmy flexibilného prizpôsobenia na vonkajšie zdroje. Napr. baktérie Flavobacterium a Pseudomonas aeruginosa začali vo svojej DNA kódovať enzýmy F-EI, F-EII, F-EIII, P-EI, P-EII schopné rozkladať nylónové zlúčeniny, ako zdroj potravy. Keby mali tieto enzýmy vzniknúť metódou pokus-omyl, o5 by sme sa vyšplhali do čísel so stovkami núl. V skutočnosti k potrebným rekombináciám na variabilnej oblasti (kódujúcich rozklad zlúčenín) tie baktérie používajú enzýmy zvané Transpozázy, schopné inteligentne manipulovať s génmi a presúvať ich časti. Je to mechanizmus.
....Podobne baktérie a ich schopnosť prisposobiť svoju odolnosť na nové antibiotiká, používajú restrikčné enzýmy, prepracovaným systémom metylácie. Takáto ochranná funkcia je u prokaroyt (medzi ktoré patria aj E-coli) súčasťou restrikčno-modifikačného systému. ....Čiže je to naprogramovaný systém adaptácie a nie výsledok náhodných pokusov.
https://www.tyden.cz/rubriky/veda-a-technika/veda/cesi-pomahaji-pochopit-jak-bakterie-vzdoruji-antibiotikum_75229.html

No skús pomocou takýchto pokusov a ťukaním do klávesnice spojeným s výberom vytvoriť napr. Archimendov zákon alebo inú zmysluplnú vetu. Prírodný výber nemá dôvod ponechať len slová, ktoré neprinášajú nijaký zmysel alebo akciu. Slovo Autobus neprináša nič zmysluplné, čo by sa dalo kdesi použiť. Žiadnu múdrosť, či poučenie. Čiže náhodné zmeny slovo autobus v budúcich krokoch rozoberú na cucky, lebo výber ho nemal prečo vybrať. (Výnimkou sú jednoslovné vety, ako Stoj!, Choď! a pod., ale takých je minimum.) Pravdepodobnosť vzniku slova autobus je 1:257 = 6103515625, čiže reálna. (Do úvahy beriem 25 znakov abecedy bez diakritiky.)
Každý ďalší znak to celé znásobí číslom 25, lebo zakaždým máme 25 možností výberu písmena. Takto sa rýchlo dostaneme do čísel presahujúcich počet atómov vesmíru. Čiže už pri vete pozostávajúcej z 60 znakov, sa dostávame k pravdepodobnostiam menším, ako 1:1080, tj. prakticky nulovým. Jednoslovných, dvojslovných či trojslovných viet nesúcich nejaký význam je drvivá menšina, než viet, ktoré sa pohybujú v rádoch desiatok znakov. Prírodný výber podľa evolučných báchoriek udržuje len informácie, ktoré majú význam pre prežitie. Rovnako teda treba zachovávať iba vety, ktoré majú význam, či nesú nejakú užitočnú informáciu pre príjemcu.
....Tak môžeš sa pustiť do toho.  ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f600

Tie zmeny na pinkách sú reverzibilné. Nikdy sa neposunú ďalej za hranice pinky. Z pinky zostane vždy pinka a nevznikne z nej andulka alebo kanárik. Variácie vrámci druhov sú normálna pozorovaná vec a môžu za to regulačné gény nacháczajúce sa v oblasti Junk DNA a epigenetika. Obe tieto veci sú prepracovaný adaptačný mechanizmus, ktorý z bunky robí ešte zložitejší systém, teda s akutnejšou potrebou programátora, než sme si predtým mysleli.

Ďalšia rozprávka o nekonečnom počte vesmírov. Reálny svet nepozná žiadne nekonečná.
https://fikacek.blog.idnes.cz/blog.aspx?c=755651
I keby poznal, existujú veci, ktoré sa nemôžu stať nikdy. Napr. aby sa na seba nakopili kamene tvoriace stĺp do výšky 500km. Podobne je nemožné, aby sa pôsobením prírodných príčin vyskladala makromolekula s reťazcom stoviek či tisícov atómov, akých je v bunkách mnoho. O stabilitu sa tam starajú enzýmy, ktoré sú sami tiež makromolekuly a iné zložité procesy. Keby tento systém neexistoval, rozbili by sa makromolekuly do pár hodín na malé fragmenty brownovým pohybom. Slabé vodíkové mostíky by padli za obeť do pár sekúnd až minút.


Kde na tie nezmysly chodíš. Ligáza nie je bunka, ale enzým ktorý pripája jednotlivé aminokyseliny k transferovej RNA, aby ich mal k dispozícii Ribozóm, ktorý podľa predlohy dát v mRNA syntetizuje bielkovinu.  No Ligáza spolu ribozómom a RNA-polymerázou tvoria komplexný mechanizmus, podiaľajúci sa na proteosyntéze. Ligáza sama o sebe je nanič - podobne ako volant od auta alebo sedadlo bicykla.

Zase tie tvoje škôlkarské predstavy - tento raz o kombinatorike. Všetky možnosti usporiadania sa nepočítajú pomocou faktoriálu, pretože náhodný výber na každom mieste vyberá z 20-tich možností - tj. 20-tich aminokyselín. Každé ďalšie políčko reťazca znovu násobí celkový počet možností číslom 20, pretože znovu je na výber jedna z 20 aminokyselín.   ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f604  
Takže správny výpočet pravdepodobnosti sú variácie s opakovaním:
20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20*20 = 4,3*1041 - Na každej pozícii reťazca môže byť vylosovaná náhodnou mutáciou jedna z 20-tich aminokyselín.
Ako už bolo spomenuté, igázy samé o sebe sú nanič. Po pripojení aminokyseliny k transferovej RNA ju nemá čo využiť. K proteosyntéze sú potrebné ďalšie enzýmy a aparáty vrátane kináz. Ribozóm má už podstatne väčšiu dĺžku a nemožnosť vzniku metódou pokus-omyl.

Koľko chemických pokusov mohlo prebehnúť za 1 miliardu = 109 rokov?
V zemských oceánoch je približne
4,5*1047 molekúl H2O.
https://www.greelane.com/sk/science-tech-math/veda/atoms-in-a-drop-of-water-609425/
Keby každú sekundu prebehla nejaká reakcia na každej moluekule zvlášť (čo je nereálne), tak za miliardu rokov by prebehlo 31536000*109*4,5*1047 =1.41912000*108*109*1047 = cca 1,4*1064 reakcii.
To je absolútny kapacitný strop možností chemickej evolúcie vo vodách na zemi, o ktorom ale vieme, že je nereálny. Číslo, ktoré by mohlo byť bližšie k realite sa pohybuje niekde pod 1030 - a aj to som riadne prehnal, lebo by museli byť všetky oceány ako kotol neustále v pohybe. Vieme, že reakcie môžu prebiehať hlavne na hladine - prípadne tam, kde dosahuje ešte energia zo Slnka - čím odpadajú hlbokomorské vody kde je tma. Ďalej vieme, že reakcie neprebiehajú každú sekundu zároveň po celej ploche všetkých hladín sveta.

Každá molekula DNA musí kódovať minimálne enzýmy DNA a RNA polymerázu, Ribozóm, nejaké kinázy a membránové proteíny, deliace bunku od okolitého agresívneho prostredia. Inak by DNA zostala len nehybne ležať, dokedy by sa vodíkové mostíky do pár sekúnd nerozbili na malé fragmenty. Hovoríme tu pri najlepšej vôli o stovkách párov bází nutného kódu, bez ktorého by neexistovali procesy translácie a replikácie ktoré činia bunku živou, inak by sa rozpadla za veľmi krátky čas..

Áno, pôsobením UV žiarenia vznikajú jednoduché krátkoreťazcové molekuly, čo nie je nič neobvyklé alebo ťažko vysvetliteľné. V stopových množstvách vznikajú aj báze, z ktorých len 4 sú použité pre stavbu RNA. Ako sa vyselektorvali len tieto 4 druhy, keď v zmesi sú tisíce ďalších rôznych molekúl a to dokonca s rôznym stáčaním roviny polarizovaného svetla, pričom vo všetkých živých organizmoch je použitá iba jedna jediná varianta stáčania polarizácie? .....Aj keby taký koncentrát "nejako vznikol", bez RNA polymerázy by žiadna RNA nevznikla. RNA sama od seba nevzniká. Ďalšie enzýmy a aparát sú potrebne na stabilizáciu tejto dlhoreťazcovej molekuly, lebo inak by sa do pár minút rozpadla. No a ku vzniku enzýmov je potrebná RNA a Ribozóm. Takže tieto srandy, ktoré uvádzaš nikam nevedú. Celý tento systém, aby fungoval, musia všetky jeho časti pracovať a byť funkčné. Inej cesty niet. Podobne - ak chceš mať funkčný počítač, nestačí mať na stole položený harddisk alebo RAM-ku či procesor. Všetky časti musia fungovať súbežne a komunikovať. Inak nemáš elektronický počítač.

Ak vedci laboratórne vyrobili nejakú RNA, použili k tomu bunkové enzýmy, ktoré extrahovali z buniek. Neexistuje žiadna RNA, ktorá sama vyrobí svoju kópiu bez RNA polymerázy alebo sa sama poskladá v nejakej skúmavke, kde sú potrebné nukleobáze. Skrátka nezmysel, ďalší hoax pre ľudí, ktorí túžobne očakávajú na nejaký záblesk nádeje o abiogenéze, no ten stále neprichádza a z princípu ani prísť nemôže. Bez výroby kópii niet evolúcie.

Tá pinka nie je nič iné, než zase len pinka. Modifikácie vrámci druhov prebiehajú. Nikdy to však neprekročí rysy charakteristické pre pinku a nestane sa z toho kanárik, andulka, vrabec či lastovička. Okrem toho zmeny vrámci druhov sú reverzibilné, nakoľko ich príčinou sú regulačné gény prípadne metylácia/demetylácia vrámci epigenetiky.


Naposledy upravil Fotón dňa 16/11/2021, 09:53, celkom upravené 1 krát.
avatar
15/11/2021, 15:17Biblický skeptik
Obrázky, ako dôkaz evolúcie  - to tu ešte nebolo. ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f600 Každý normálny súdny človek na obrázkoch vidí hotové druhy s plne vyvinutým funkčným fenotypom. Živočíchy s rýznymi kombináciami fenotypu nie sú dôkaz evolúcie, ale kreativity stvoriteľa.

Obrázky, respektíve fotky so zdrojmi sú dokazy medzičlánkov. Požadovali ste kreacionisti medzičlánky, na, tu ich máte. 
Stvoriteľ chce aby sme verili že ryby boli stále len ryby a že to nefunguje tak, že sa ryby zmenia na suchozemské živočíchy, a ako dokaz nám k tomu dá skupinu rýb, ktorým sa vytvorili pozemské "ruky"; "nohy" a zo žiabier sa im pretvárajú plúca ??? To je veľmi čudné dokazovanie nemennosti rýb, naopak, dáva to pušný prach evolucionistom, ktorými sa týmto len potvrdzujú ich teorie. Prečo teda Stvoriteľ v biblii nám nenecháva na pochybách že stvoril stvorením, no vo vede nám dáva pravý opak toho si to myslieť ? Achh, zabudol som, to tá schíza.


Koľko nemyslenia treba k tomu, aby bol pre niekoho počet veriacich vedcov v evolúciu dôkaz?  ďalší kreacionistický pokus vyvrátiť evolúciu (?)  Icon_biggrin  98% vedcov pred rokom 1998 verilo v spomaľujúcu sa expanziu Vesmíru. Začiatkom minulého storočia verilo v Éter, či neandertálcov, ako prechodný článok. Argumentačné klamy boli odkjakživa základom tvojho naivného nemyslenia. V tomto prípade sa volá Red Herring:
"Dovolávání se autority (argumentum ad verecundiam nebo argumentum ab auctoritate) spočívá v tom, že se na podporu určitého tvrzení uvede, že s ním souhlasí nějaký pramen, který je považovaný za autoritativní (např. významný odborník, organizace, která se zabývá danou problematikou, známá publikace na dané téma). Ačkoli lze předpokládat, že kvalitní odborná publikace obsahuje převážně pravdivá tvrzení, že významní odborníci rozumějí své problematice a podobně, samotný fakt, že se tvrzení těší podpoře autorit, neznamená, že je toto tvrzení pravdivé"


Možno že ty žiješ v nejakom svojom imaginárnom svete, ale ja žijem v realite, a v nej to proste nefunguje tak, že zopár "samobádateľov" má pravdu, kým vyštudovaná vedecká obec ako konsensus sa mýli. Nefunguje to takto v žiadnom odvetví, či už vo farmácii, v očkovaní, v súdnictve, v historii, vo vede či technike..

Ked potrebuješ ísť na operáciu, zájdeš k vyškoleným chirurgom a nie k nejakému "samochirurgovi" čo sa učil sám operovať na bábike, a pozrel si zopár videí na youtube. Ked sa riadiš protiepidemiologickými opatreniami riadiš sa opatreniami ktorý zaviedol konsensus odborníkov, nebudeš azda počúvať antirúškarov ktorý si dačo iné vygooglovali. Takto je to so všetkým, aj s evolúciou. Ked chcem zistiť ako sa vytvorili zvieratá, spýtam sa na to biologov a vedeckého konsensu. Nebudem chodiť za nejakými "samobádatelmi".


.....Tu máš zoznam 3000 vedcov, ktorí odmietli darwinizmus, ako nevedecký:
https://www.rae.org/essay-links/darwinskeptics/

Ty asi stále nerozumieš tomu kto je to vedec. Vedec je ten čo pracuje vo vedeckej obci, a nie kto si googli články na nete alebo pozerá videá z youtube. Dokonca ani učitelia biologie na školách sa neoznačujú za "vedcov". 

Za druhé, napísať o niekom niečo može hocikto. Ja tam v tom zozname vidím len to, že nejaký týpek si dovolil dakde dakoho napísať, prečo tam nie sú podpisy jednotlivých členov o ktorých zoznam píše ? Alebo audionahrávky v ktorých by členovia potvrdzovali že sa hlása k stvoreniu ? 

Za tretie, matematici, fyzici, ITčkári uvedení v zozname, nemajú spoločné s evolúciou v podstate nič. K evolúcii maju čo povedať biologia a paleontologovia. Matematik ti nemá ako vedieť vypočítať štatistiku, pokiaľ nerozumie ako vzniká evolúcia. To vie iba biolog. 

K vedcom som ti štatistiku dal, je to okolo 98%, hoci iné dáta ukazujú ešte vyššie čísla, niektoré 99%, iné dokonca 99,9%. Takže ked zoberem strednú hodnotu dostanem okolo 99%. 



Tak veľa vedcov skeptických k darwinizmu poukazuje na fakt, že ani zďaleka nebol vedecky dokázaný - ako povedzme Špeciálna teória relativity. Neexistuje 3000 vedcov, skeptických voči STR, pretože STR bola vedecky dokázaná a je opakovane dokazovaná. Naviac pred samotnými dôkazmi STR krásne vychádzala z matematického odvodenia, známych faktov o rýchlosti svetla ako hranici. O Neodarwinizme sa však dá ukázať pravý opak.
Znovu, ja tam žiadne potvrdenia dotyčných ľudí nevidím, nikde nemáš 3000 nezávislých svedectiev od jednotlivých ľudí že sa hlásia ku stvoreniu. Za druhé, dotyční nie sú vedci, vedec je ten kto pracuje vo vedecjek komunite. Za tretie, vedecký konsensus je ohladom evolúcii na 99%, naozaj nepoznám vedecké odvetie kde by sa 99% vedcov mýlila....




Tvrdenie bez dôkazu. Dokáž, že fyzikálne a biologické zákony sú schopné vytvárať programy a veľké množstvá špecificky funkčnej informácie. Dovtedy je to len rozprávka pre naivné deti. ....Ani trilión rokov by ti nestačilo k tomu, aby vznikol čo i len jeden komplikovaný program. Pravdepodobnosť je:
1 ku (Celkový počet potrebných inštrukcii)(Počet inštrukcii v reťazci daného programu)
Napr G-proteíny, ktoré sa zúčastňujú na prenose signálov z vonka do vnútra bunky. Najmenšie G-proteíny majú 290 aminokyselinových zvyškov. Aminokyselín sa používa 20, čiže 20300 = 10(290*log 20) = 2*10377 mutačných pokusov, čiže vzhľadom na vek Vesmíru a množstvo atómov v ňom, prakticky nulová pravdepodobnosť vzniku i toho najjednoduchšieho signálneho G-proteínu.

Lenskiho E-Coli, ktoré boli počas krátkej doby schopné pohlcovať citrát. Vznik nového druhu vtáka z Galapágskych piniek, či jašteričky na Galapágach ktorým sa vytvorila v tráviacom trakte Bauhinská chlopňa (cecal valve), Najlepšie na tom je to, že všetky tieto veci sú z kreacionistického hladiska na základe ich náhodných sekvenciach ako extrémne nepravdepodobné, no ako vidno stali sa. Sekvencie teda nefungujú náhodne ale plánovane, takže hocijaká sekvencia može vzniknuť len na základe prírodnych procesov.


Kreacionisti vychádzajú z nesprávneho predpokladu, že presná sekvencia aminokyselín je čisto na základe náhody - pokusu a omylu. Ibaže takto to nefunguje. Zoberme si vymyslené slovo "Autobus". Do klávesnice náhodne so zavretými očami naťukám 7 písmen dostanem slovo "Affksps". Príroda funguje tak, že správne zoradená písmena ponechá a tie nesprávne vylúči. Takže ponechajú sa písmena "A" a "s" na prvom a 7 mieste a písmena od 2 po 6 miesto "ffksp" sa odstránia a znovu sa premiešajú. Ďaľším náhodným pokusom dostanem slovo "Audksos". Druhé písmeno sa spolu s prvým a posledným ponechá a ostatné sa vyhodia a dochádza k ďaľšiemu pokusu. Dostanem slovo "Audksus". A znova a znova to isté, až dokiaľ sa nevytvorí slovo "Autobus" a teda správna sekvencia. Takýmto spôsobom by sa požadovaná sekvencia dosiahla veľmi rýchlo. Vyzerá to teda ako puzzle, kde sa správne skladačky spolu spoja, kým tie nesprávne sa nespoja, no tie nesprávne sa s tými správnymi spoja v ďaľších pokusoch. Toto podporuje rýchle vytváranie nových informácii a teda sekvencií ktoré som už vymenoval v súvislosti s 3 udalostami ktoré som už vymenoval. Okrem toho existujú ešte dalšie príklady zrýchlenej evolúcii, kedy sa stihlo vytvoriť niečo čo by bolo z náhodnej štatistiky extrémne nepravdepodobné. 



https://elifesciences.org/articles/55414
https://polach.blog.idnes.cz/blog.aspx?c=40861
https://tech.sme.sk/c/20705192/na-galapagoch-sa-pred-zrakmi-vedcov-vyvinul-novy-druh-vtaka.html
https://dennikn.sk/954137/evolucia-v-priamom-prenose-na-galapagoch-sa-vyvinul-novy-druh-pinky/

Po tretie, Kreacionisti ignorujú fakt, že okrem nášho vesmíru môže existovať nekonečne veľa vesmírov, alebo náš vesmír môže byť večný, teda existujúci od večnosti, neustále rodiaci/zanikajúci vo veľkom Tresku. Akákoľvek nepravdepodobná udalosť sa v nekonečnom počte vesmíroch, alebo hoc aj v jednom večnom vesmíre zaiste stane skôr či neskôr ! Nemuselo by existovať ani nekonečné množstvo vesmírov, ani by náš vesmír nemusel byť večný, stačilo by ak by existovalo trebárs počet vesmírov viac než 10 na 1040 a už by sa všetky hore uvedené "nepravdepodobné" udalosti odohrali s vysokou mierou pravdepodobnosti !

Po štvrté, Kreacionisti používajú nesprávne výpočty, pretože svoje štatistiky odvádzajú od samovoľného vzniku DNA, pretože sú toho názoru, že DNA je prvou bunkou, ktorá sa dokáže rozmnožovať, samoreplikovať (samoopravovať) a v ktorej prebiehajú katalytické reakcie. Ibaže to nie je pravda. Existujú aj oveľa jednoduchšie "bunky" od DNA, ktoré sa dokážu rozmnožovať, samoreplikovať a v ktorých prebiehajú katalytické reakcie. Takou je napríklad peptid ligáza, ktorá sa skladá z jedného reťazca 32 aminokyselín. Táto jednoduchá "bunka" spĺňa všetky faktory na to aby sa zachovala a aby sa evolučne mohla vytvárať v zložitejšie bunky.

Aminokyseliny v reťazci peptid ligázy sú presne zoradené : RMKQLEEKVYELLSKVACLEYEVARLKKVGE. Zoradenie čo i len jednej aminokyseliny inak by spravilo peptid lygázu nefunkčnou hore uvedených vlastností. Na základe štatistik, pravdepodobnosť, že sa náhodne zoradí 32 aminokyselín do toho správneho poradia, vypočítame cez 32! faktoriál. Po malom zaokrúhlení smerom nadol je to číslo 10 na 32.
Toto číslo je síce veľké, matematici by povedali že extrémne nepravdepodobné, ale znova si treba uvedomiť, že toto je číslo náhodného vzniku peptidu ligázy správnym zoradením 32 aminokyselín počas prvého chemického pokusu a na jednej Zemi ! Avšak v priebehu rannej Zeme, a teda obdobia trvajúcom minimálne 1 miliardu rokov prebehlo nespočetne veľa chemických pokusov, a nielen na našej Zemi, ale očividne aj na ostatných planétach v našom vesmíre ! Spojením týchto dvoch faktorov sa nám pravdepodobnosť rapídne zvyšuje. Presné výpočty sú však ponekiaľ zdĺhavé, nič menej vedci sa na tieto výpočty podujali a zistili, že náhodné vytvorenie peptid ligázy IBA na rannej Zemi by netrvalo vyše roka !

Ešte jednoduchšie by to bolo so samovoľným vytvorením jednoduchej molekuly RNA, bez jej zložitých chemických štruktúrových reťazcov ako ju poznáme dnes. Táto "proto" RNA by obsahovala výlučne adenín, cytosín, uracil, guanín, ktoré ako dnes vieme sa dajú vytvoriť obyčajným zahriatím chemikálie formahydu a skrze UV žiarenie. Zdá se teda, že pokiaľ máme k dispozícii formamyd, slnečné svetlo a vodu ohriatu na teplotu okolo 100 stupňov Celsia, vznikajú samy od seba základné stavebné bloky RNA. K týmto 4 zlúčeninám treba pridať ešte na Zemi hojne zastúpený cukor a fosfát z ktorého sa skladá "stena" RNA. Čo je však najdôležitejšie je to, že vedcom sa už takúto "proto RNA" podarilo vyrobiť a pozorovali jej katalytické a rozmnožovacie funkcie, čo ju robí za ideálneho kandidáta z ktorého sa vplyvom evolúcie a prírodného výberu mohla vytvárať stále viac a viac zložitejšie "bunka" až k dnešnej RNA a nakoniec i DNA.

https://www.planetopia.cz/pravdepodobnost-abiogeneze.html
https://polach.blog.idnes.cz/blog.aspx?c=143261



Zmeny na galapážskych pinkách sú zapríčinené regulačnými génmi, ktoré reagujú na vonkajšie podnety, čiže programom, ktorý musel niekto naprogramovať. Keď pripojím k PC nové USB zariadenie, tiež si všetko sám nakonfiguruje a nie je to žiadna náhodami riadená evolúcia.
Mal som na mysli vytvorenie nového druhu, a nie vytvorenie silnejších zobákov, vid hore články. článok.
Fotón
Obrázky, ako dôkaz evolúcie  - to tu ešte nebolo. ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f600 Každý normálny súdny človek na tých obrázkoch vidí hotové druhy s plne vyvinutým funkčným fenotypom. Živočíchy s rýznymi kombináciami fenotypu nie sú dôkaz evolúcie, ale kreativity stvoriteľa.


Koľko nemyslenia treba k tomu, aby bol pre niekoho počet vedcov veriacich v evolúciu dôkaz?  Very Happy  "98%" vedcov pred rokom 1998 verilo v spomaľujúcu sa expanziu Vesmíru. Začiatkom minulého storočia verilo v Éter, či neandertálcov, ako prechodný článok. Argumentačné klamy boli odkjakživa základom tvojho naivného nemyslenia. V tomto prípade sa volá Red Herring:
"Dovolávání se autority (argumentum ad verecundiam nebo argumentum ab auctoritate) spočívá v tom, že se na podporu určitého tvrzení uvede, že s ním souhlasí nějaký pramen, který je považovaný za autoritativní (např. významný odborník, organizace, která se zabývá danou problematikou, známá publikace na dané téma). Ačkoli lze předpokládat, že kvalitní odborná publikace obsahuje převážně pravdivá tvrzení, že významní odborníci rozumějí své problematice a podobně, samotný fakt, že se tvrzení těší podpoře autorit, neznamená, že je toto tvrzení pravdivé"
.....Tu máš zoznam 3000 vedcov, ktorí odmietli darwinizmus, ako nevedecký:
https://www.rae.org/essay-links/darwinskeptics/
(....ale ani to nie je dôkaz. Keď nevieš, ako majú vyzerať dôkazy, nepleť sa do vedy, ale choď radšej lúskať fazuľky...)
Tak veľa vedcov skeptických k darwinizmu poukazuje na fakt, že ani zďaleka nebol vedecky dokázaný - ako napr. Špeciálna teória relativity. Neexistuje 3000 vedcov, skeptických voči STR, pretože STR bola vedecky dokázaná a je opakovane dokazovaná. Každý si ju môže overiť, kto vlatní napr atómové hodiny s presnosťou jednotky nanosekúnd. Tieto hodiny majú presnosť lepšiu ako 1 nanosekunda v prípade, že sa oscilátor kalibruje z výstupu atómov Cézia 133  (sú súčasťou zariadenia) raz za sekundu (čo však vyžaduje väčší odber z batérii):
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  Fig1-W
https://www.gpsworld.com/new-miniature-atomic-clock-aids-positioning-in-difficult-environments/
Pomocou tohoto modulu obsahujúceho atómové (Céziové) hodiny sa dá overiť aj platnosť Všeobecnej teórie relativity. Dvoje hodiny sa nastavia, aby išli súbežne. Jedni nechám bežať celý deň v malej nadmorskej výške pod 300 m a druhé nad 1000 metrov nad morom. Po skončení merania rozdiel činí okolo 15 - 20 nanosekúnd (v závislosti ná výškovom rozdieli.

Naviac pred samotnými dôkazmi STR krásne vychádzala z matematického odvodenia, známych faktov o rýchlosti svetla ako hranici. O Neodarwinizme sa však dá ukázať pravý opak.

Tvrdenie bez dôkazu. Dokáž, že fyzikálne a biologické zákony sú schopné vytvárať programy a veľké množstvá špecificky funkčnej informácie. Dovtedy je to len rozprávka pre naivné deti. ....Ani trilión rokov by ti nestačilo k tomu, aby vznikol čo i len jeden komplikovaný program. Pravdepodobnosť je:
1 ku (Celkový počet potrebných inštrukcii)(Počet inštrukcii v reťazci daného programu)
Napr G-proteíny, ktoré sa zúčastňujú na prenose signálov z vonka do vnútra bunky. Najmenšie G-proteíny majú 290 aminokyselinových zvyškov. Aminokyselín sa používa 20, čiže 20300 = 10(290*log 20) = 2*10377 mutačných pokusov, čiže vzhľadom na vek Vesmíru a množstvo atómov v ňom, prakticky nulová pravdepodobnosť vzniku i toho najjednoduchšieho signálneho G-proteínu.

Zmeny na galapážskych pinkách sú zapríčinené regulačnými génmi, ktoré reagujú na vonkajšie podnety, čiže programom, ktorý musel niekto naprogramovať. Keď pripojím k PC nové USB zariadenie, tiež si všetko sám nakonfiguruje a nie je to žiadna náhodami riadená evolúcia.
....Na tých obrázkoch nevidno žiadnu makroevolúciu, ale hotové druhy s plne funkčným fenotypom. Žiadne známky vývoja. Jedinci oklamaní Darwinizmom sú aj vtákopyska schopní považovať za dôkaz evolúcie. Pritom je to hotový druh, len s atypickou kombináciou inak plne vyvinutého funkčného fenotypu.


Naposledy upravil Fotón dňa 15/11/2021, 15:23, celkom upravené 1 krát.
avatar
14/11/2021, 20:31Biblický skeptik
To mal byť pokus o nejakú srandu? ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f424

Pravda sa ťažko pozerá i počúva, hlavne ak to vyvracia náboženskú vieru  Smile



Číslo 98% je nezvratný vedecký dôkaz evolúcie.  ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f602

Pod sa sťažovat vedcom, alebo na lampáren 



Veď to je predsa každému normálnemu človeku jasné. Každá zmena fenotypu je naprogramovaná programátorom života.

Ziaden programátor života, ale čisto fyzikálne a biologické zákony. Tomu programátorovi by som možno aj uveril, kebyže tu nemáme 4,5 miliardy rokov starú Zem, a stovky milionov nadvládu dinosaurov, ktorí sa zrazu "programátorovi" znepáčili a poslal na nich meteoriť  Mad lol! scratch



Vraj náhodné mutácie vedia spolu s výberom čarovať. Nejaké príklady by neboli? ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f604

Comu sa čuduješ, mikroevolúcia je pozorovaná aj voľným okom napríklad u Galapágskych piniek, a u zvierat. Co sa týka makroevolúcie tam som ti dával obrázky, príkladov bolo uvedených kopu.
Fotón
Ok, srandu si viete robiť. Zasmiali sme sa.... No a teraz tie dôkazy. Vraj náhodné mutácie vedia spolu s výberom čarovať. Nejaké príklady by neboli? ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f604
Fotón
"Mutácie nie sú náhodné.... "

Veď to je predsa každému normálnemu človeku jasné. Každá zmena fenotypu je naprogramovaná programátorom života.



Asi že to nie je také nelogické, ked tomu verí 98% vedeckej obce....

Číslo 98% je nezvratný vedecký dôkaz evolúcie.  ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f602
Fotón
To mal byť pokus o nejakú srandu? ďalší kreacionistický pokus vyvrátiť evolúciu (?)  1f424
avatar
13/11/2021, 20:52Biblický skeptik
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  Ev1
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  Ev2

Axotl mexický

ďalší kreacionistický pokus vyvrátiť evolúciu (?)  EV3


Ryba s tenkými predĺženými nohami - tripod fish

ďalší kreacionistický pokus vyvrátiť evolúciu (?)  Ev4

4 : Ryba s nohami - Mohawk fish
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  EV5
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  Ev4s

5 : Ryba s poloplutvami - Rybie anabas

ďalší kreacionistický pokus vyvrátiť evolúciu (?)  Ev6

Nemá nohy, ale na jeho plutvách opúšťa vodu a môže stráviť na zemi až osem hodín. Je schopný vyliezť na kameň, ker, a dokonca aj na strom. Tieto poloplutvy sú teda predchodcami nôh rýb
https://sk.public-welfare.com/4336517-fish-with-legs-and-those-who-are-taken-for-them

6 : Ryba s krídlami a nohami - Lepidotrigla papilio
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  EV7
https://www.australiangeographic.com.au/blogs/creatura-blog/2014/11/eastern-spiny-gurnard-fish

7 : Skamenelina ryby Tiktalik
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  EV9
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  EV10

Dvojdyšník
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  EV15
Dvojdyšníky majú okrem žiaber aj jednoduché pľúca na dýchanie vzduchu.Môžu žiť v močiaroch s nepriaznivými kyslíkovými podmienkami a dokážu prežiť aj mimo vody. ich plutvy nie sú typické rybie plutve, ale sú značne zosilnené, takže sa nimi ryba dokáže pohybovať aj na zemskom povrchu. Dvojdyšníky sú prikladom evolúcie morských zvierat na suchozemské, ktorým sa postupom času vytvorili pľúca na dýchanie vzduchu a z plutiev "nohy" na chodenie po zemskom povrchu.
https://sk.wikipedia.org/wiki/Dvojdy%C5%A1n%C3%ADky


10 : Ryba s nohami - Ogcocephalus DarwinI
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  Ev16

11 : Ryba s nohami - Brachionichthys hirsutus

ďalší kreacionistický pokus vyvrátiť evolúciu (?)  EV17

Atd, Atd.... Nechce sa mi tu kopírovať všetky morské medzičlánky.... len dnes ich poznáme vyše 20, a to máme preskúmaných ani nie jednu miliontinu celého oceánu. Ak by sme preskúmali cleý oceán, našli by sme stovky milionov medzičlánkov... tu je dokaz, niet viac čo treba.
avatar
13/11/2021, 20:38Biblický skeptik
 Skôr to vyzerá tak, že niekto len skúšal, ako ďaleko až môže zájsť robením si srandy z ľudí a z ich nemyslenia.

Asi že to nie je také nelogické, ked tomu verí 98% vedeckej obce....
ďalší kreacionistický pokus vyvrátiť evolúciu (?)  Hfhg


Evolúcia sama seba vyvrátila od chvíle, keď do nej zaviedli náhodné mutácie. Kto nad tým aspoň trošku rozmýšľa vie, že veľké množstvá funkčne špecifickej informácie nemôžu povstať z čisto chemických a fyzikálnych predchodcov. Ani pri najlepšom výbere, nie je z čoho vyberať. To je ako losovať s písmenami abecedy a z výsledkov vyberať zmysluplné vety. Žiadnu báseň alebo poučku týmo spôsobom nikto nevytvorí.

Mutácie nie sú náhodné. Zivočích ktorý prechádza z morského prostredia na suchozemské, vždy u neho dochádza k mutáciam, a vždy mu mutácie sposobia to, že mu narastú pozemské nohy. Nie je to o náhode. 

Informácia nie je nič iné, než určitá sekvencia písmenok, stačí správne poradie a je tu na svete informácia. Táto sekvencia nie je náhodná, závisí na základe toho aké prostredie vplýva na jednotlivca. Ked na jednotlivca bude neustále pražiť slnko, písmenka sa mu v tele zoradia do vopred nastavenej schémy ktoré má za cieľ "stmavnúť pokožku". Ked ryba bude neustále chodiť na pevninu tak sa jej písmenka zoradia do správneho kodu ktoré majú za cieľ "vytvoriť pozemskú končatinu".
Fotón
Evolúcia sama seba vyvrátila od chvíle, keď do nej zaviedli náhodné mutácie. Kto nad tým aspoň trošku rozmýšľa vie, že veľké množstvá funkčne špecifickej informácie nemôžu povstať z čisto chemických a fyzikálnych predchodcov. Ani pri najlepšom výbere, nie je z čoho vyberať. To je ako losovať s písmenami abecedy a z výsledkov vyberať zmysluplné vety. Žiadnu báseň alebo poučku týmo spôsobom nikto nevytvorí. Skôr to vyzerá tak, že niekto len skúšal, ako ďaleko až môže zájsť robením si srandy z ľudí a z ich nemyslenia. Zdá sa, že sa mu to podarilo. Zistilo sa, že ľudia sú schopní uveriť akejkoľvek hlúposti. Napriek dôkladnému výskumu, žiadne materiálne príčiny, ktorými by bolo možné demonštrovať schopnosť vyprodukovať veľké množstvá špecifickej informácie, neboli objavené. Úplne zbytočne vyhodené peniaze na výskum, veď to bolo predsa jasné hneď od začiatku.

....Naopak: Inteligentnými príčinami možno demonštrovať schopnosť vyprodukovať veľké množstvá takejto špecifickej informácie. Dôkazy sú teda jasné.

Rozum zostáva stáť, čomu všetkému sú schopní uveriť dokonca aj vzdelaní ľudia, len aby popreli Boha. Priblblé..... Rovnako zostáva rozum stáť nad tým, ako je možné, že podobne vzdelaní ľudia rozpútali 2 svetovú vojnu a holokaust.
Povolenie tohoto fóra:
Môžete odpovedať na témy v tomto fóre.